PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00452g00240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 271aa    MW: 30114.2 Da    PI: 9.1246
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00452g00240.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.8e-343892155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Peaxi162Scf00452g00240.1 38 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 92
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-323593IPR009057Homeodomain-like
PROSITE profilePS5129412.8013595IPR017930Myb domain
SuperFamilySSF466891.11E-163793IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-243893IPR006447Myb domain, plants
PfamPF002491.7E-84090IPR001005SANT/Myb domain
PfamPF143792.3E-22134173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MFHPNKKLPS SMNSHDRISN ICVQSAGDSG LVLTTDPKPR LRWTVELHER FVDAVAQLGG  60
PDKATPKTIM RVMGVKGLTL YHLKSHLQKF RLGKQPHKEF NDHTLKDGDR AASLEPLRNS  120
ASSSGLIGRN MNEMQMEVQR RLHEQLEVQR HLQLRIEAQG KYMQTILEKA CQTLGAGENI  180
MASAGISYKG IGGMTTTLDM KELIGSPPPR PLSFSSFQDL NSIYGSGHDH ELELNTQSTS  240
SPLDGFMDHD LCLGKKSTRP STPNNYSHSN N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869241e-148JQ686924.1 Nicotiana tabacum cultivar SR1 myb family transcription factor APL (APL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565370.11e-126PREDICTED: myb family transcription factor APL isoform X4
RefseqXP_016565371.11e-127PREDICTED: myb family transcription factor APL isoform X5
SwissprotQ9SAK51e-103APL_ARATH; Myb family transcription factor APL
TrEMBLV9LXI21e-122V9LXI2_TOBAC; Myb family transcription factor APL
STRINGSolyc12g017370.1.11e-120(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79422231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-103G2-like family protein